![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Dodecameric ferritin homolog [47250] (16 species) |
![]() | Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries) Uniprot Q8VP75 |
![]() | Domain d2yw7j1: 2yw7 J:17-157 [153806] automatically matched to d1n1qa_ mutant |
PDB Entry: 2yw7 (more details), 3.3 Å
SCOPe Domain Sequences for d2yw7j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yw7j1 a.25.1.1 (J:17-157) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]} vadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevaeriatlg kspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledldlvsqd lliahagelekfqwfvrahle
Timeline for d2yw7j1: