Lineage for d2yw7d1 (2yw7 D:17-155)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2701715Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2701985Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries)
    Uniprot Q8VP75
  8. 2701999Domain d2yw7d1: 2yw7 D:17-155 [153800]
    automatically matched to d1n1qa_
    mutant

Details for d2yw7d1

PDB Entry: 2yw7 (more details), 3.3 Å

PDB Description: Crystal structure of C-terminal deletion mutant of Mycobacterium smegmatis Dps
PDB Compounds: (D:) starvation-induced DNA protecting protein

SCOPe Domain Sequences for d2yw7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yw7d1 a.25.1.1 (D:17-155) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
vadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevaeriatlg
kspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledldlvsqd
lliahagelekfqwfvrah

SCOPe Domain Coordinates for d2yw7d1:

Click to download the PDB-style file with coordinates for d2yw7d1.
(The format of our PDB-style files is described here.)

Timeline for d2yw7d1: