| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein Dodecameric ferritin homolog [47250] (16 species) |
| Species Mycobacterium smegmatis [TaxId:1772] [109784] (5 PDB entries) Uniprot Q8VP75 |
| Domain d2yw7d1: 2yw7 D:17-155 [153800] automatically matched to d1n1qa_ mutant |
PDB Entry: 2yw7 (more details), 3.3 Å
SCOPe Domain Sequences for d2yw7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yw7d1 a.25.1.1 (D:17-155) Dodecameric ferritin homolog {Mycobacterium smegmatis [TaxId: 1772]}
vadllqkqlstyndlhltlkhvhwnvvgpnfigvhemidpqvelvrgyadevaeriatlg
kspkgtpgaiikdrtwddysverdtvqahlaaldlvyngviedtrksiekledldlvsqd
lliahagelekfqwfvrah
Timeline for d2yw7d1: