Lineage for d2yvxb1 (2yvx B:7-131)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2727528Superfamily a.118.26: MgtE N-terminal domain-like [158791] (2 families) (S)
    made of short helices; approximately 2.5 helices per turn of superhelix
    automatically mapped to Pfam PF03448
  5. 2727529Family a.118.26.1: MgtE N-terminal domain-like [158792] (1 protein)
    Pfam PF03448
  6. 2727530Protein Magnesium transporter MgtE [158793] (2 species)
  7. 2727534Species Thermus thermophilus [TaxId:274] [158795] (2 PDB entries)
    Uniprot Q5SMG8 7-131
  8. 2727538Domain d2yvxb1: 2yvx B:7-131 [153784]
    Other proteins in same PDB: d2yvxa2, d2yvxa3, d2yvxb2, d2yvxb3, d2yvxc2, d2yvxc3, d2yvxd2, d2yvxd3
    automatically matched to 2YVX A:7-131
    complexed with mg

Details for d2yvxb1

PDB Entry: 2yvx (more details), 3.5 Å

PDB Description: Crystal structure of magnesium transporter MgtE
PDB Compounds: (B:) Mg2+ transporter MgtE

SCOPe Domain Sequences for d2yvxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvxb1 a.118.26.1 (B:7-131) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]}
vslqealqegdtralrevleeihpqdllalwdelkgehryvvltllpkakaaevlshlsp
eeqaeylktlppwrlreileelslddladalqavrkedpayfqrlkdlldprtraeveal
aryee

SCOPe Domain Coordinates for d2yvxb1:

Click to download the PDB-style file with coordinates for d2yvxb1.
(The format of our PDB-style files is described here.)

Timeline for d2yvxb1: