| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.26: MgtE N-terminal domain-like [158791] (2 families) ![]() made of short helices; approximately 2.5 helices per turn of superhelix automatically mapped to Pfam PF03448 |
| Family a.118.26.1: MgtE N-terminal domain-like [158792] (1 protein) Pfam PF03448 |
| Protein Magnesium transporter MgtE [158793] (2 species) |
| Species Thermus thermophilus [TaxId:274] [158795] (2 PDB entries) Uniprot Q5SMG8 7-131 |
| Domain d2yvxd1: 2yvx D:7-131 [153790] Other proteins in same PDB: d2yvxa2, d2yvxa3, d2yvxb2, d2yvxb3, d2yvxc2, d2yvxc3, d2yvxd2, d2yvxd3 automatically matched to 2YVX A:7-131 complexed with mg |
PDB Entry: 2yvx (more details), 3.5 Å
SCOPe Domain Sequences for d2yvxd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvxd1 a.118.26.1 (D:7-131) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]}
vslqealqegdtralrevleeihpqdllalwdelkgehryvvltllpkakaaevlshlsp
eeqaeylktlppwrlreileelslddladalqavrkedpayfqrlkdlldprtraeveal
aryee
Timeline for d2yvxd1: