SCOPe 2.01: Domain d2ysda1: 2ysd A:15-45

Lineage for d2ysda1 (2ysd A:15-45)

1. Root: SCOPe 2.01

2. Class k: Designed proteins [58788] (44 folds)

3. Fold k.22: WW domain-based designs [58912] (1 superfamily)

4. Superfamily k.22.1: WW domain-based designs [58913] (1 family)

5. Family k.22.1.1: WW domain-based designs [58914] (2 proteins)

6. Protein Prototype WW domain [58915] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [161326] (6 PDB entries)

8. Domain d2ysda1: 2ysd A:15-45 [153747]
   automatically matched to d1e0ma_

Details for d2ysda1

PDB Entry: 2ysd

PDB Description: solution structure of the first ww domain from the human membrane- associated guanylate kinase, ww and pdz domain-containing protein 1. magi-1

PDB Compounds: (A:) Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1

SCOPe Domain Sequences for d2ysda1:

Sequence; same for both SEQRES and ATOM records:

>d2ysda1 k.22.1.1 (A:15-45) Prototype WW domain {Mouse (Mus musculus) [TaxId: 10090]}
lpenwemaytengevyfidhntkttswldpr

Timeline for d2ysda1:

• d2ysda1 first appeared in SCOP 1.75
  
• d2ysda1 appears in SCOPe 2.02
  
• d2ysda1 appears in the current release, SCOPe 2.08, called d2ysda2