SCOPe 2.08: Domain d2ysda2: 2ysd A:8-51

Lineage for d2ysda2 (2ysd A:8-51)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.1: WW domain [51045] (2 families)

5. Family b.72.1.1: WW domain [51046] (13 proteins)

6. Protein automated matches [192459] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [161325] (20 PDB entries)

8. Domain d2ysda2: 2ysd A:8-51 [153747]
   Other proteins in same PDB: d2ysda3, d2ysda4
   automated match to d1i5hw_

Details for d2ysda2

PDB Entry: 2ysd

PDB Description: solution structure of the first ww domain from the human membrane- associated guanylate kinase, ww and pdz domain-containing protein 1. magi-1

PDB Compounds: (A:) Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1

SCOPe Domain Sequences for d2ysda2:

Sequence; same for both SEQRES and ATOM records:

>d2ysda2 b.72.1.1 (A:8-51) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aednlgplpenwemaytengevyfidhntkttswldprclnkqq

Timeline for d2ysda2:

• d2ysda2 first appeared in SCOP 1.75, called d2ysda1
  
• d2ysda2 appears in SCOPe 2.07