Lineage for d1e0ma_ (1e0m A:)
- Root: SCOPe 2.01
Class k: Designed proteins [58788] (44 folds) 
Fold k.22: WW domain-based designs [58912] (1 superfamily) Superfamily k.22.1: WW domain-based designs [58913] (1 family) 
Family k.22.1.1: WW domain-based designs [58914] (2 proteins) 
Protein Prototype WW domain [58915] (3 species) 
Species Synthetic [58916] (1 PDB entry) 
Domain d1e0ma_: 1e0m A: [46452]
Details for d1e0ma_
PDB Entry: 1e0m (more details)
PDB Description: prototype ww domain
PDB Compounds: (A:) wwprototypeSCOPe Domain Sequences for d1e0ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e0ma_ k.22.1.1 (A:) Prototype WW domain {Synthetic}
smglppgwdeykthngktyyynhntktstwtdprmss
SCOPe Domain Coordinates for d1e0ma_:
Click to download the PDB-style file with coordinates for d1e0ma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e0ma_:
- d1e0ma_ first appeared (with stable ids) in SCOP 1.55
- d1e0ma_ appears in SCOP 1.75
- d1e0ma_ appears in SCOPe 2.02
- d1e0ma_ appears in the current release, SCOPe 2.08
View in 3D