Lineage for d2vyta2 (2vyt A:140-243)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 947168Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 947277Family b.34.9.3: MBT repeat [89299] (4 proteins)
    Pfam PF02820
    contains extended 'arm', N-terminal to the common fold core
  6. 947308Protein Scml2 protein [89300] (1 species)
    duplication: contains tandem repeat of two MBT repeats
  7. 947309Species Human (Homo sapiens) [TaxId:9606] [89301] (3 PDB entries)
  8. 947317Domain d2vyta2: 2vyt A:140-243 [153714]
    automatically matched to d1oi1a2
    complexed with mlz, pge

Details for d2vyta2

PDB Entry: 2vyt (more details), 1.9 Å

PDB Description: the mbt repeats of human scml2 bind to peptides containing mono methylated lysine.
PDB Compounds: (A:) sex comb on midleg-like protein 2

SCOPe Domain Sequences for d2vyta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vyta2 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]}
swpmflletlngsemasatlfkkeppkpplnnfkvgmkleaidkknpylicpatigdvkg
devhitfdgwsgafdywckydsrdifpagwcrltgdvlqppgts

SCOPe Domain Coordinates for d2vyta2:

Click to download the PDB-style file with coordinates for d2vyta2.
(The format of our PDB-style files is described here.)

Timeline for d2vyta2: