![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) ![]() |
![]() | Family b.34.9.3: MBT repeat [89299] (4 proteins) Pfam PF02820 contains extended 'arm', N-terminal to the common fold core |
![]() | Protein Scml2 protein [89300] (1 species) duplication: contains tandem repeat of two MBT repeats |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89301] (2 PDB entries) |
![]() | Domain d2vyta2: 2vyt A:140-243 [153714] automated match to d1oi1a2 complexed with mlz, pge |
PDB Entry: 2vyt (more details), 1.9 Å
SCOPe Domain Sequences for d2vyta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vyta2 b.34.9.3 (A:140-243) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]} swpmflletlngsemasatlfkkeppkpplnnfkvgmkleaidkknpylicpatigdvkg devhitfdgwsgafdywckydsrdifpagwcrltgdvlqppgts
Timeline for d2vyta2: