SCOPe 2.08: Domain d2vyta1: 2vyt A:30-135

Lineage for d2vyta1 (2vyt A:30-135)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.3: MBT repeat [89299] (4 proteins)
   Pfam PF02820
   contains extended 'arm', N-terminal to the common fold core

6. Protein Scml2 protein [89300] (1 species)
   duplication: contains tandem repeat of two MBT repeats

7. Species Human (Homo sapiens) [TaxId:9606] [89301] (2 PDB entries)

8. Domain d2vyta1: 2vyt A:30-135 [153713]
   automated match to d1oi1a1
   complexed with mlz, pge

Details for d2vyta1

PDB Entry: 2vyt, 1.9 Å

PDB Description: the mbt repeats of human scml2 bind to peptides containing mono methylated lysine.

PDB Compounds: (A:) sex comb on midleg-like protein 2

SCOPe Domain Sequences for d2vyta1:

Sequence; same for both SEQRES and ATOM records:

>d2vyta1 b.34.9.3 (A:30-135) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]}
rddfhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvigit
garlrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplgyq

Timeline for d2vyta1:

• d2vyta1 first appeared in SCOP 1.75
  
• d2vyta1 appears in SCOPe 2.07