PDB entry 2vyt

View 2vyt on RCSB PDB site
Description: the mbt repeats of human scml2 bind to peptides containing mono methylated lysine.
Class: transcription
Keywords: mono methylated peptides, mbt repeats, transcription, phosphoprotein, alternative splicing, transcription regulation, nucleus, repressor, chromatin, human scml2
Deposited on 2008-07-28, released 2008-08-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2167
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sex comb on midleg-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VYT
      • engineered mutation (124)
    • Uniprot Q9UQR0 (Start-220)
    Domains in SCOPe 2.01: d2vyta1, d2vyta2
  • Chain 'B':
    Compound: sex comb on midleg-like protein 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VYT
    • Uniprot Q9UQR0 (Start-220)
  • Heterogens: MLZ, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vytA (A:)
    gstssvqrddfhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvci
    atvigitgarlrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplgyqmntsswp
    mflletlngsemasatlfkkeppkpplnnfkvgmkleaidkknpylicpatigdvkgdev
    hitfdgwsgafdywckydsrdifpagwcrltgdvlqppgts
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vytA (A:)
    rddfhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvigit
    garlrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplgyqmntsswpmflletl
    ngsemasatlfkkeppkpplnnfkvgmkleaidkknpylicpatigdvkgdevhitfdgw
    sgafdywckydsrdifpagwcrltgdvlqppgts
    

  • Chain 'B':
    No sequence available.