Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.34: Mechanosensitive channel protein MscS (YggB), transmembrane region [82860] (1 superfamily) oligomeric fold; 3 transmembrane helices per subunit |
Superfamily f.34.1: Mechanosensitive channel protein MscS (YggB), transmembrane region [82861] (1 family) |
Family f.34.1.1: Mechanosensitive channel protein MscS (YggB), transmembrane region [82862] (1 protein) |
Protein Mechanosensitive channel protein MscS (YggB), transmembrane region [82863] (1 species) homoheptameric protein |
Species Escherichia coli [TaxId:562] [82864] (2 PDB entries) |
Domain d2vv5b3: 2vv5 B:27-112 [153618] Other proteins in same PDB: d2vv5a1, d2vv5a2, d2vv5b1, d2vv5b2, d2vv5c1, d2vv5c2, d2vv5d1, d2vv5d2, d2vv5e1, d2vv5e2, d2vv5f1, d2vv5f2, d2vv5g1, d2vv5g2 automatically matched to d2oaua3 |
PDB Entry: 2vv5 (more details), 3.45 Å
SCOPe Domain Sequences for d2vv5b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vv5b3 f.34.1.1 (B:27-112) Mechanosensitive channel protein MscS (YggB), transmembrane region {Escherichia coli [TaxId: 562]} yavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaal grvgvqtasviavlgaaglvvglalq
Timeline for d2vv5b3: