Lineage for d2vv5b3 (2vv5 B:27-112)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028151Fold f.34: Mechanosensitive channel protein MscS (YggB), transmembrane region [82860] (1 superfamily)
    oligomeric fold; 3 transmembrane helices per subunit
  4. 3028152Superfamily f.34.1: Mechanosensitive channel protein MscS (YggB), transmembrane region [82861] (1 family) (S)
  5. 3028153Family f.34.1.1: Mechanosensitive channel protein MscS (YggB), transmembrane region [82862] (1 protein)
  6. 3028154Protein Mechanosensitive channel protein MscS (YggB), transmembrane region [82863] (1 species)
    homoheptameric protein
  7. 3028155Species Escherichia coli [TaxId:562] [82864] (2 PDB entries)
  8. 3028157Domain d2vv5b3: 2vv5 B:27-112 [153618]
    Other proteins in same PDB: d2vv5a1, d2vv5a2, d2vv5b1, d2vv5b2, d2vv5c1, d2vv5c2, d2vv5d1, d2vv5d2, d2vv5e1, d2vv5e2, d2vv5f1, d2vv5f2, d2vv5g1, d2vv5g2
    automatically matched to d2oaua3

Details for d2vv5b3

PDB Entry: 2vv5 (more details), 3.45 Å

PDB Description: the open structure of mscs
PDB Compounds: (B:) Small-conductance mechanosensitive channel

SCOPe Domain Sequences for d2vv5b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vv5b3 f.34.1.1 (B:27-112) Mechanosensitive channel protein MscS (YggB), transmembrane region {Escherichia coli [TaxId: 562]}
yavnivaalaiiivgliiarmisnavnrlmisrkidatvadflsalvrygiiaftliaal
grvgvqtasviavlgaaglvvglalq

SCOPe Domain Coordinates for d2vv5b3:

Click to download the PDB-style file with coordinates for d2vv5b3.
(The format of our PDB-style files is described here.)

Timeline for d2vv5b3: