Lineage for d2vv5c1 (2vv5 C:113-179)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787348Family b.38.1.3: Mechanosensitive channel protein MscS (YggB), middle domain [82090] (1 protein)
  6. 2787349Protein Mechanosensitive channel protein MscS (YggB), middle domain [82091] (1 species)
    forms homoheptameric ring structure very similar to those of the archaeal and eukaryotic Sm proteins
  7. 2787350Species Escherichia coli [TaxId:562] [82092] (2 PDB entries)
  8. 2787353Domain d2vv5c1: 2vv5 C:113-179 [153619]
    Other proteins in same PDB: d2vv5a2, d2vv5a3, d2vv5b2, d2vv5b3, d2vv5c2, d2vv5c3, d2vv5d2, d2vv5d3, d2vv5e2, d2vv5e3, d2vv5f2, d2vv5f3, d2vv5g2, d2vv5g3
    automatically matched to d2oaua1

Details for d2vv5c1

PDB Entry: 2vv5 (more details), 3.45 Å

PDB Description: the open structure of mscs
PDB Compounds: (C:) Small-conductance mechanosensitive channel

SCOPe Domain Sequences for d2vv5c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vv5c1 b.38.1.3 (C:113-179) Mechanosensitive channel protein MscS (YggB), middle domain {Escherichia coli [TaxId: 562]}
gslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiia
gniinfs

SCOPe Domain Coordinates for d2vv5c1:

Click to download the PDB-style file with coordinates for d2vv5c1.
(The format of our PDB-style files is described here.)

Timeline for d2vv5c1: