SCOPe 2.08: Domain d2vv5g1: 2vv5 G:113-179

Lineage for d2vv5g1 (2vv5 G:113-179)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.3: Mechanosensitive channel protein MscS (YggB), middle domain [82090] (1 protein)

6. Protein Mechanosensitive channel protein MscS (YggB), middle domain [82091] (1 species)
   forms homoheptameric ring structure very similar to those of the archaeal and eukaryotic Sm proteins

7. Species Escherichia coli [TaxId:562] [82092] (2 PDB entries)

8. Domain d2vv5g1: 2vv5 G:113-179 [153631]
   Other proteins in same PDB: d2vv5a2, d2vv5a3, d2vv5b2, d2vv5b3, d2vv5c2, d2vv5c3, d2vv5d2, d2vv5d3, d2vv5e2, d2vv5e3, d2vv5f2, d2vv5f3, d2vv5g2, d2vv5g3
   automatically matched to d2oaua1

Details for d2vv5g1

PDB Entry: 2vv5, 3.45 Å

PDB Description: the open structure of mscs

PDB Compounds: (G:) Small-conductance mechanosensitive channel

SCOPe Domain Sequences for d2vv5g1:

Sequence; same for both SEQRES and ATOM records:

>d2vv5g1 b.38.1.3 (G:113-179) Mechanosensitive channel protein MscS (YggB), middle domain {Escherichia coli [TaxId: 562]}
gslsnlaagvllvmfrpfrageyvdlggvagtvlsvqifsttmrtadgkiivipngkiia
gniinfs

Timeline for d2vv5g1:

• d2vv5g1 first appeared in SCOP 1.75
  
• d2vv5g1 appears in SCOPe 2.07