SCOPe 2.02: Domain d2vj8a3: 2vj8 A:209-460

Lineage for d2vj8a3 (2vj8 A:209-460)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.13: Leukotriene A4 hydrolase catalytic domain [64338] (1 protein)
   adopts thermolysin-like fold

6. Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64340] (15 PDB entries)
   Uniprot P09960

8. Domain d2vj8a3: 2vj8 A:209-460 [153185]
   Other proteins in same PDB: d2vj8a1, d2vj8a2
   automatically matched to d1gw6a3
   complexed with act, ha2, imd, yb, zn

Details for d2vj8a3

PDB Entry: 2vj8, 1.8 Å

PDB Description: complex of human leukotriene a4 hydrolase with a hydroxamic acid inhibitor

PDB Compounds: (A:) lta4h protein

SCOPe Domain Sequences for d2vj8a3:

Sequence; same for both SEQRES and ATOM records:

>d2vj8a3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpdvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

Timeline for d2vj8a3:

• d2vj8a3 first appeared in SCOP 1.75
  
• d2vj8a3 appears in SCOPe 2.01
  
• d2vj8a3 appears in SCOPe 2.03
  
• d2vj8a3 appears in the current release, SCOPe 2.08