Lineage for d1gw6a3 (1gw6 A:209-460)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1211973Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1211974Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1212753Family d.92.1.13: Leukotriene A4 hydrolase catalytic domain [64338] (1 protein)
    adopts thermolysin-like fold
  6. 1212754Protein Leukotriene A4 hydrolase catalytic domain [64339] (1 species)
  7. 1212755Species Human (Homo sapiens) [TaxId:9606] [64340] (15 PDB entries)
    Uniprot P09960
  8. 1212764Domain d1gw6a3: 1gw6 A:209-460 [83344]
    Other proteins in same PDB: d1gw6a1, d1gw6a2
    complexed with act, bes, imd, yb, zn; mutant

Details for d1gw6a3

PDB Entry: 1gw6 (more details), 2.2 Å

PDB Description: structure of leukotriene a4 hydrolase d375n mutant
PDB Compounds: (A:) Leukotriene A-4 hydrolase

SCOPe Domain Sequences for d1gw6a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gw6a3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
lesrqigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyg
gmenpcltfvtptllagdkslsnviaheishswtgnlvtnktwdhfwlneghtvylerhi
cgrlfgekfrhfnalggwgelqnsvktfgethpftklvvdltdidpnvayssvpyekgfa
llfyleqllggpeiflgflkayvekfsyksittddwkdflysyfkdkvdvlnqvdwnawl
yspglppikpny

SCOPe Domain Coordinates for d1gw6a3:

Click to download the PDB-style file with coordinates for d1gw6a3.
(The format of our PDB-style files is described here.)

Timeline for d1gw6a3: