SCOPe 2.01: Domain d2vj3a1: 2vj3 A:411-452

Lineage for d2vj3a1 (2vj3 A:411-452)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein Neurogenic locus notch homolog protein 1, Notch1 [118243] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118244] (2 PDB entries)
   Uniprot P46531 411-526

8. Domain d2vj3a1: 2vj3 A:411-452 [153180]
   automatically matched to d1toza1
   complexed with ca, cl, na

Details for d2vj3a1

PDB Entry: 2vj3, 2.6 Å

PDB Description: human notch-1 egfs 11-13

PDB Compounds: (A:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d2vj3a1:

Sequence; same for both SEQRES and ATOM records:

>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]}
qdvdecslganpcehagkcintlgsfecqclqgytgprceid

Timeline for d2vj3a1:

• d2vj3a1 first appeared in SCOP 1.75
  
• d2vj3a1 appears in SCOPe 2.02
  
• d2vj3a1 appears in the current release, SCOPe 2.08