Class g: Small proteins [56992] (90 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (7 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein Neurogenic locus notch homolog protein 1, Notch1 [118243] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [118244] (2 PDB entries) Uniprot P46531 411-526 |
Domain d1toza1: 1toz A:411-452 [112605] |
PDB Entry: 1toz (more details)
SCOPe Domain Sequences for d1toza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1toza1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} qdvdecslganpcehagkcintlgsfecqclqgytgprceid
Timeline for d1toza1: