Lineage for d2vj3a1 (2vj3 A:411-452)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031827Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 3031828Protein automated matches [226968] (5 species)
    not a true protein
  7. 3031829Species Human (Homo sapiens) [TaxId:9606] [225423] (30 PDB entries)
  8. 3031875Domain d2vj3a1: 2vj3 A:411-452 [153180]
    Other proteins in same PDB: d2vj3a4
    automated match to d2vj3a1
    complexed with ca, cl, na

Details for d2vj3a1

PDB Entry: 2vj3 (more details), 2.6 Å

PDB Description: human notch-1 egfs 11-13
PDB Compounds: (A:) Neurogenic locus notch homolog protein 1

SCOPe Domain Sequences for d2vj3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vj3a1 g.3.11.0 (A:411-452) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qdvdecslganpcehagkcintlgsfecqclqgytgprceid

SCOPe Domain Coordinates for d2vj3a1:

Click to download the PDB-style file with coordinates for d2vj3a1.
(The format of our PDB-style files is described here.)

Timeline for d2vj3a1: