PDB entry 2vj3

View 2vj3 on RCSB PDB site
Description: Human Notch-1 EGFs 11-13
Class: transcription
Keywords: transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway, differentiation, phosphorylation, egf-like domain, transcription regulation, receptor, activator, ank repeat, signalling, polymorphism, glycoprotein, extracellular, egf, notch, jagged, nucleus, calcium, membrane
Deposited on 2007-12-06, released 2008-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-07-05, with a file datestamp of 2017-06-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neurogenic locus notch homolog protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2VJ3 (118-End)
      • conflict (68)
    • Uniprot P46531 (2-117)
    Domains in SCOPe 2.08: d2vj3a1, d2vj3a2, d2vj3a3, d2vj3a4
  • Heterogens: CA, NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2vj3A (A:)
    saqdvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndatcl
    dqigefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcqvd
    lhhildaqkmvwnhr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2vj3A (A:)
    qdvdecslganpcehagkcintlgsfecqclqgytgprceidvnecvsnpcqndatcldq
    igefqcicmpgyegvhcevntdecasspclhngrcldkinefqcecptgftghlcqvdlh