Lineage for d2vhni2 (2vhn I:1-72)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946680Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2946681Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2946682Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2946686Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2946692Species Escherichia coli [TaxId:562] [160201] (29 PDB entries)
    Uniprot P0A7J7 1-72
  8. 2946714Domain d2vhni2: 2vhn I:1-72 [153104]
    Other proteins in same PDB: d2vhn01, d2vhn11, d2vhn31, d2vhn41, d2vhnc1, d2vhnc2, d2vhnd1, d2vhne1, d2vhnf1, d2vhng1, d2vhng2, d2vhnh1, d2vhnh2, d2vhni1, d2vhnj1, d2vhnk1, d2vhnl1, d2vhnm1, d2vhnn1, d2vhno1, d2vhnp1, d2vhnq1, d2vhnr1, d2vhns1, d2vhnt1, d2vhnu1, d2vhnv1, d2vhnw1, d2vhnx1, d2vhny1, d2vhnz1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhni2

PDB Entry: 2vhn (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome. (Structure 2 of 4)
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2vhni2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhni2 d.47.1.1 (I:1-72) Ribosomal protein L11, N-terminal domain {Escherichia coli [TaxId: 562]}
akkvqayvklqvaagmanpsppvgpalgqqgvnimefckafnaktdsiekglpipvvitv
yadrsftfvtkt

SCOPe Domain Coordinates for d2vhni2:

Click to download the PDB-style file with coordinates for d2vhni2.
(The format of our PDB-style files is described here.)

Timeline for d2vhni2: