Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein 70S ribosome functional complex [58121] (4 species) |
Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
Domain d2vhnp1: 2vhn P:1-114 [153111] Other proteins in same PDB: d2vhn01, d2vhn31, d2vhn41, d2vhnc1, d2vhnc2, d2vhnd1, d2vhne1, d2vhnf1, d2vhng1, d2vhng2, d2vhnh1, d2vhnh2, d2vhni1, d2vhni2, d2vhnj1, d2vhnk1, d2vhnl1, d2vhnm1, d2vhnn1, d2vhno1, d2vhnq1, d2vhnr1, d2vhns1, d2vhnt1, d2vhnu1, d2vhnv1, d2vhnw1, d2vhnx1, d2vhny1, d2vhnz1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2vhn (more details), 3.74 Å
SCOPe Domain Sequences for d2vhnp1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhnp1 i.1.1.1 (P:1-114) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} sniikqleqeqmkqdvpsfrpgdtvevkvwvvegskkrlqafegvviairnrglhsaftv rkisngegvervfqthspvvdsisvkrrgavrkaklyylrertgkaarikerln
Timeline for d2vhnp1:
View in 3D Domains from other chains: (mouse over for more information) d2vhn01, d2vhn11, d2vhn31, d2vhn41, d2vhnc1, d2vhnc2, d2vhnd1, d2vhne1, d2vhnf1, d2vhng1, d2vhng2, d2vhnh1, d2vhnh2, d2vhni1, d2vhni2, d2vhnj1, d2vhnk1, d2vhnl1, d2vhnm1, d2vhnn1, d2vhno1, d2vhnq1, d2vhnr1, d2vhns1, d2vhnt1, d2vhnu1, d2vhnv1, d2vhnw1, d2vhnx1, d2vhny1, d2vhnz1 |