Lineage for d2vf4x1 (2vf4 X:243-601)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1006340Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 1006341Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 1006342Family c.80.1.1: double-SIS domain [53698] (4 proteins)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 1006343Protein "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) [53699] (1 species)
  7. 1006344Species Escherichia coli [TaxId:562] [53700] (8 PDB entries)
  8. 1006354Domain d2vf4x1: 2vf4 X:243-601 [153027]
    automatically matched to d2j6ha1

Details for d2vf4x1

PDB Entry: 2vf4 (more details), 2.95 Å

PDB Description: e. coli glucosamine-6-p synthase
PDB Compounds: (X:) glucosamine--fructose-6-phosphate aminotransferase

SCOPe Domain Sequences for d2vf4x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vf4x1 c.80.1.1 (X:243-601) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]}
gdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilacgt
synsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglrls
kelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvaklsrl
kgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypialeg
alklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarggq
lyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprnl

SCOPe Domain Coordinates for d2vf4x1:

Click to download the PDB-style file with coordinates for d2vf4x1.
(The format of our PDB-style files is described here.)

Timeline for d2vf4x1: