Lineage for d2vf4x_ (2vf4 X:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908082Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2908083Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2908084Family c.80.1.1: double-SIS domain [53698] (5 proteins)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 2908116Protein automated matches [227069] (2 species)
    not a true protein
  7. 2908117Species Escherichia coli [TaxId:562] [233109] (5 PDB entries)
  8. 2908130Domain d2vf4x_: 2vf4 X: [153027]
    automated match to d1mosa_

Details for d2vf4x_

PDB Entry: 2vf4 (more details), 2.95 Å

PDB Description: e. coli glucosamine-6-p synthase
PDB Compounds: (X:) glucosamine--fructose-6-phosphate aminotransferase

SCOPe Domain Sequences for d2vf4x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vf4x_ c.80.1.1 (X:) automated matches {Escherichia coli [TaxId: 562]}
gdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilacgt
synsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglrls
kelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvaklsrl
kgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypialeg
alklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarggq
lyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprnl

SCOPe Domain Coordinates for d2vf4x_:

Click to download the PDB-style file with coordinates for d2vf4x_.
(The format of our PDB-style files is described here.)

Timeline for d2vf4x_: