Lineage for d2j6ha1 (2j6h A:241-608)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.80: SIS domain [53696] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345Superfamily c.80.1: SIS domain [53697] (4 families) 
Family c.80.1.1: double-SIS domain [53698] (4 proteins)
duplication: consists of two SIS domains related by pseudo dyad
Protein "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) [53699] (1 species) Species Escherichia coli [TaxId:562] [53700] (8 PDB entries) 
Domain d2j6ha1: 2j6h A:241-608 [138084]
Other proteins in same PDB: d2j6ha2, d2j6hb2
automatically matched to d1jxaa1
complexed with g6q, onl
Details for d2j6ha1
PDB Entry: 2j6h (more details), 2.35 Å
PDB Description: e. coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo-l-norleucine
PDB Compounds: (A:) glucosamine-fructose-6-phosphate aminotransferaseSCOPe Domain Sequences for d2j6ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j6ha1 c.80.1.1 (A:241-608) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]}
dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
rlkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
laksvtve
SCOPe Domain Coordinates for d2j6ha1:
Click to download the PDB-style file with coordinates for d2j6ha1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2j6ha1:
- d2j6ha1 first appeared in SCOP 1.73
- d2j6ha1 appears in SCOP 1.75
- d2j6ha1 appears in SCOPe 2.02
- d2j6ha1 appears in the current release, SCOPe 2.08
View in 3D
