SCOP 1.73: Domain d2j6ha1: 2j6h A:241-608

Lineage for d2j6ha1 (2j6h A:241-608)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.80: SIS domain [53696] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345

4. Superfamily c.80.1: SIS domain [53697] (3 families)

5. Family c.80.1.1: double-SIS domain [53698] (4 proteins)
   duplication: consists of two SIS domains related by pseudo dyad

6. Protein "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) [53699] (1 species)

7. Species Escherichia coli [TaxId:562] [53700] (6 PDB entries)

8. Domain d2j6ha1: 2j6h A:241-608 [138084]
   Other proteins in same PDB: d2j6ha2, d2j6hb2
   automatically matched to d1jxaa1
   complexed with g6q, onl

Details for d2j6ha1

PDB Entry: 2j6h, 2.35 Å

PDB Description: e. coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo-l-norleucine

PDB Compounds: (A:) glucosamine-fructose-6-phosphate aminotransferase

SCOP Domain Sequences for d2j6ha1:

Sequence; same for both SEQRES and ATOM records:

>d2j6ha1 c.80.1.1 (A:241-608) "Isomerase domain" of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]}
dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
rlkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
laksvtve

Timeline for d2j6ha1:

• d2j6ha1 is new in SCOP 1.73
  
• d2j6ha1 appears in SCOP 1.75
  
• d2j6ha1 appears in the current release, SCOPe 2.08