SCOPe 2.08: Domain d2veaa3: 2vea A:4-130

Lineage for d2veaa3 (2vea A:4-130)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
   Pfam PF08446; PAS_2

6. Protein Phytochrome-like protein Cph1 [160675] (1 species)

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [160676] (1 PDB entry)
   Uniprot Q55168 4-130

8. Domain d2veaa3: 2vea A:4-130 [153024]
   Other proteins in same PDB: d2veaa1, d2veaa2, d2veaa4
   complexed with cyc

Details for d2veaa3

PDB Entry: 2vea, 2.21 Å

PDB Description: The complete sensory module of the cyanobacterial phytochrome Cph1 in the Pr-state.

PDB Compounds: (A:) phytochrome-like protein cph1

SCOPe Domain Sequences for d2veaa3:

Sequence, based on SEQRES records:

>d2veaa3 d.110.3.9 (A:4-130) Phytochrome-like protein Cph1 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tvqlsdqslrqletlaihtahliqphglvvvlqepdltisqisanctgilgrspedllgr
tlgevfdsfqidpiqsrltagqisslnpsklwarvmgddfvifdgvfhrnsdgllvcele
paytsdn

Sequence, based on observed residues (ATOM records):

>d2veaa3 d.110.3.9 (A:4-130) Phytochrome-like protein Cph1 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tvqlsdqslrqletlaihtahliqphglvvvlqepdltisqisanctgilgrspedllgr
tlgevfdsfltagqisslnpsklwarvmdfvifdgvfhrnsdgllvcelepaytsdn

Timeline for d2veaa3:

• d2veaa3 first appeared in SCOP 1.75
  
• d2veaa3 appears in SCOPe 2.07