Lineage for d2veaa2 (2vea A:327-514)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970232Family d.110.2.4: Phytochrome-specific domain [160664] (2 proteins)
    Pfam PF00360
  6. 2970253Protein Phytochrome-like protein Cph1 [160667] (1 species)
  7. 2970254Species Synechocystis sp. PCC 6803 [TaxId:1148] [160668] (1 PDB entry)
    Uniprot Q55168 327-514
  8. 2970255Domain d2veaa2: 2vea A:327-514 [153023]
    Other proteins in same PDB: d2veaa1, d2veaa3, d2veaa4
    complexed with cyc

Details for d2veaa2

PDB Entry: 2vea (more details), 2.21 Å

PDB Description: The complete sensory module of the cyanobacterial phytochrome Cph1 in the Pr-state.
PDB Compounds: (A:) phytochrome-like protein cph1

SCOPe Domain Sequences for d2veaa2:

Sequence, based on SEQRES records: (download)

>d2veaa2 d.110.2.4 (A:327-514) Phytochrome-like protein Cph1 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
yrvqlaeheavlldkmttaadfvegltnhpdrllgltgsqgaaicfgeklilvgetpdek
avqyllqwlenrevqdvfftsslsqiypdavnfksvasgllaipiarhnfllwfrpevlq
tvnwggdpnhayeatqedgkielhprqsfdlwkeivrlqslpwqsveiqsalalkkaivn
lilrqaee

Sequence, based on observed residues (ATOM records): (download)

>d2veaa2 d.110.2.4 (A:327-514) Phytochrome-like protein Cph1 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
yrvqlaeheavlldkmttaadfvegltnhpdrllgltgsqgaaicfgeklilvgetpdek
avqyllqwlenrevqdvfftsslsqiypdavnfksvasgllaipiarhnfllwfrpevlq
tvnwggdpnhayeatqkielhprqsfdlwkeivrlqslpwqsveiqsalalkkaivnlil
rqaee

SCOPe Domain Coordinates for d2veaa2:

Click to download the PDB-style file with coordinates for d2veaa2.
(The format of our PDB-style files is described here.)

Timeline for d2veaa2: