SCOPe 2.08: Domain d2v9va1: 2v9v A:377-437

Lineage for d2v9va1 (2v9v A:377-437)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (2 proteins)

6. Protein automated matches [254632] (1 species)
   not a true protein

7. Species Moorella thermoacetica [TaxId:1525] [255606] (1 PDB entry)

8. Domain d2v9va1: 2v9v A:377-437 [152809]
   automated match to d2v9va1
   complexed with cl, na

Details for d2v9va1

PDB Entry: 2v9v, 1.1 Å

PDB Description: crystal structure of moorella thermoacetica selb(377-511)

PDB Compounds: (A:) Selenocysteine-specific elongation factor

SCOPe Domain Sequences for d2v9va1:

Sequence; same for both SEQRES and ATOM records:

>d2v9va1 a.4.5.35 (A:377-437) automated matches {Moorella thermoacetica [TaxId: 1525]}
gspekilaqiiqehregldwqeaatraslsleetrkllqsmaaagqvtllrvendlyais
t

Timeline for d2v9va1:

• d2v9va1 first appeared in SCOP 1.75
  
• d2v9va1 appears in SCOPe 2.07