PDB entry 2v9v

View 2v9v on RCSB PDB site
Description: Crystal Structure of Moorella thermoacetica SelB(377-511)
Class: transcription
Keywords: transcription, protein conformational change, transcription elongation factor selb, selenoprotein biosynthesis, protein dynamics, nucleotide-binding, cytoplasm, GTP-binding, selenocysteine, winged-helix domain, protein biosynthesis
Deposited on 2007-08-27, released 2007-09-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Selenocysteine-specific elongation factor
    Species: Moorella thermoacetica [TaxId:1525]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2v9va1, d2v9va2
  • Heterogens: CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2v9vA (A:)
    gspekilaqiiqehregldwqeaatraslsleetrkllqsmaaagqvtllrvendlyais
    teryqawwqavtraleefhsryplrpglareelrsryfsrlparvyqalleewsregrlq
    laantvalagftpsf