SCOPe 2.08: Domain d2v69m_: 2v69 M:

Lineage for d2v69m_ (2v69 M:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein automated matches [190066] (7 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (9 PDB entries)

8. Domain d2v69m_: 2v69 M: [152688]
   Other proteins in same PDB: d2v69a1, d2v69a2, d2v69b1, d2v69b2, d2v69c1, d2v69c2, d2v69d1, d2v69d2, d2v69e1, d2v69e2, d2v69f1, d2v69f2, d2v69g1, d2v69g2, d2v69h1, d2v69h2
   automated match to d1ir21_
   complexed with cap, edo, mg; mutant

Details for d2v69m_

PDB Entry: 2v69, 2.8 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large- subunit mutation d473e

PDB Compounds: (M:) ribulose bisphosphate carboxylase small chain 1

SCOPe Domain Sequences for d2v69m_:

Sequence; same for both SEQRES and ATOM records:

>d2v69m_ d.73.1.1 (M:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv

Timeline for d2v69m_:

• d2v69m_ first appeared in SCOP 1.75, called d2v69m1
  
• d2v69m_ appears in SCOPe 2.07