| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) ![]() |
| Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
| Protein automated matches [190066] (7 species) not a true protein |
| Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [186785] (9 PDB entries) |
| Domain d2v69o_: 2v69 O: [152690] Other proteins in same PDB: d2v69a1, d2v69a2, d2v69b1, d2v69b2, d2v69c1, d2v69c2, d2v69d1, d2v69d2, d2v69e1, d2v69e2, d2v69f1, d2v69f2, d2v69g1, d2v69g2, d2v69h1, d2v69h2 automated match to d1ir21_ complexed with cap, edo, mg; mutant |
PDB Entry: 2v69 (more details), 2.8 Å
SCOPe Domain Sequences for d2v69o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v69o_ d.73.1.1 (O:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
mmvwtpvnnkmfetfsylppltdeqiaaqvdyivangwipclefaeadkayvsnesairf
gsvsclyydnrywtmwklpmfgcrdpmqvlreivactkafpdayvrlvafdnqkqvqimg
flvqrpktardfqpankrsv
Timeline for d2v69o_: