SCOPe 2.08: Domain d2v69b2: 2v69 B:10-149

Lineage for d2v69b2 (2v69 B:10-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [225547] (9 PDB entries)

8. Domain d2v69b2: 2v69 B:10-149 [152671]
   Other proteins in same PDB: d2v69a1, d2v69b1, d2v69c1, d2v69d1, d2v69e1, d2v69f1, d2v69g1, d2v69h1, d2v69i_, d2v69j_, d2v69k_, d2v69l_, d2v69m_, d2v69n_, d2v69o_, d2v69p_
   automated match to d1gk8a2
   complexed with cap, edo, mg; mutant

Details for d2v69b2

PDB Entry: 2v69, 2.8 Å

PDB Description: crystal structure of chlamydomonas reinhardtii rubisco with a large- subunit mutation d473e

PDB Compounds: (B:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d2v69b2:

Sequence; same for both SEQRES and ATOM records:

>d2v69b2 d.58.9.0 (B:10-149) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
gagfkagvkdyrltyytpdyvvrdtdilaafrmtpqpgvppeecgaavaaesstgtwttv
wtdgltsldrykgrcydiepvpgednqyiayvaypidlfeegsvtnmftsivgnvfgfka
lralrledlrippayvktfv

Timeline for d2v69b2:

• d2v69b2 first appeared in SCOP 1.75
  
• d2v69b2 appears in SCOPe 2.07