Lineage for d2v48f1 (2v48 F:1-101)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2560503Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 2560504Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 2560505Protein Ribosomal protein S6 [54997] (4 species)
  7. 2560535Species Thermus thermophilus [TaxId:274] [54998] (53 PDB entries)
    Uniprot P23370
  8. 2560572Domain d2v48f1: 2v48 F:1-101 [152524]
    Other proteins in same PDB: d2v48b1, d2v48d1, d2v48e1, d2v48g1, d2v48h1, d2v48i1, d2v48j1, d2v48k1, d2v48l1, d2v48m1, d2v48n1, d2v48o1, d2v48p1, d2v48q1, d2v48r1, d2v48s1, d2v48t1, d2v48u1, d2v48y1
    complexed with mg, zn
    complexed with mg, zn

Details for d2v48f1

PDB Entry: 2v48 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 3 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 2.
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2v48f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v48f1 d.58.14.1 (F:1-101) Ribosomal protein S6 {Thermus thermophilus [TaxId: 274]}
mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
lwyqvempedrvndlarelrirdnvrrvmvvksqepflana

SCOPe Domain Coordinates for d2v48f1:

Click to download the PDB-style file with coordinates for d2v48f1.
(The format of our PDB-style files is described here.)

Timeline for d2v48f1: