Lineage for d2v48i1 (2v48 I:2-128)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537230Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2537343Protein Ribosomal protein S9 [54218] (2 species)
  7. 2537371Species Thermus thermophilus [TaxId:274] [54219] (39 PDB entries)
    Uniprot P80374
  8. 2537399Domain d2v48i1: 2v48 I:2-128 [152527]
    Other proteins in same PDB: d2v48b1, d2v48d1, d2v48e1, d2v48f1, d2v48g1, d2v48h1, d2v48j1, d2v48k1, d2v48l1, d2v48m1, d2v48n1, d2v48o1, d2v48p1, d2v48q1, d2v48r1, d2v48s1, d2v48t1, d2v48u1, d2v48y1
    complexed with mg, zn
    complexed with mg, zn

Details for d2v48i1

PDB Entry: 2v48 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 3 of 4). This file contains the 30S subunit, mRNA, P-site ASL, E-site tRNA and RRF for Molecule 2.
PDB Compounds: (I:) 30S ribosomal protein S9

SCOPe Domain Sequences for d2v48i1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v48i1 d.14.1.1 (I:2-128) Ribosomal protein S9 {Thermus thermophilus [TaxId: 274]}
eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
apqyskr

SCOPe Domain Coordinates for d2v48i1:

Click to download the PDB-style file with coordinates for d2v48i1.
(The format of our PDB-style files is described here.)

Timeline for d2v48i1: