![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) consists of 2 different alpha+beta subdomains arranged in a 4-layer structure: b/a/b/a |
![]() | Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) ![]() automatically mapped to Pfam PF00410 |
![]() | Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
![]() | Protein Ribosomal protein S8 [56049] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [56051] (46 PDB entries) Uniprot P24319 |
![]() | Domain d2v48h1: 2v48 H:1-138 [152526] Other proteins in same PDB: d2v48b1, d2v48d1, d2v48e1, d2v48f1, d2v48g1, d2v48i1, d2v48j1, d2v48k1, d2v48l1, d2v48m1, d2v48n1, d2v48o1, d2v48p1, d2v48q1, d2v48r1, d2v48s1, d2v48t1, d2v48u1, d2v48y1 complexed with mg, zn complexed with mg, zn |
PDB Entry: 2v48 (more details), 3.8 Å
SCOPe Domain Sequences for d2v48h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v48h1 d.140.1.1 (H:1-138) Ribosomal protein S8 {Thermus thermophilus [TaxId: 274]} mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt drearklgvggelicevw
Timeline for d2v48h1: