Lineage for d2v47t1 (2v47 T:1-138)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783937Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 2784217Family b.34.5.6: Ribosomal protein L19 [141245] (1 protein)
    Pfam PF01245
  6. 2784218Protein Ribosomal protein L19 [141246] (3 species)
  7. 2784236Species Thermus thermophilus [TaxId:274] [159030] (4 PDB entries)
    Uniprot P60490 1-138
  8. 2784239Domain d2v47t1: 2v47 T:1-138 [152516]
    Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47u1, d2v47v1, d2v47y1, d2v47z1

Details for d2v47t1

PDB Entry: 2v47 (more details), 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 2 of 4). This file contains the 50S subunit for Molecule 1.
PDB Compounds: (T:) 50S ribosomal protein L19

SCOPe Domain Sequences for d2v47t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v47t1 b.34.5.6 (T:1-138) Ribosomal protein L19 {Thermus thermophilus [TaxId: 274]}
mnrgaliklvesryvrtdlpefrpgdtvrvsykvkegnrtriqdfegivirirrngfntt
ftvrkvsygvgverifplhspliqkidivqrgrarraklyfirnlsdreirrklradrkr
idqdraaeraakeeaqka

SCOPe Domain Coordinates for d2v47t1:

Click to download the PDB-style file with coordinates for d2v47t1.
(The format of our PDB-style files is described here.)

Timeline for d2v47t1: