Class g: Small proteins [56992] (100 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families) |
Family g.41.8.6: Ribosomal protein L33p [144203] (1 protein) Pfam PF00471; corresponds structurally and functionally to the ribosomal L44e from eukaryota and archaea; metal ion-binding site is lost in most members |
Protein Ribosomal protein L33p [144204] (3 species) |
Species Thermus thermophilus [TaxId:274] [161180] (9 PDB entries) Uniprot P35871 8-52 |
Domain d2v4761: 2v47 6:9-53 [152507] Other proteins in same PDB: d2v4741, d2v4751, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47y1, d2v47z1 |
PDB Entry: 2v47 (more details), 3.8 Å
SCOPe Domain Sequences for d2v4761:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v4761 g.41.8.6 (6:9-53) Ribosomal protein L33p {Thermus thermophilus [TaxId: 274]} lllecteckrrnyateknkrntpnklelrkycpwcrkhtvhrevk
Timeline for d2v4761: