SCOPe 2.08: Domain d2v47h2: 2v47 H:83-171

Lineage for d2v47h2 (2v47 H:83-171)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)
   automatically mapped to Pfam PF00347

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Thermus thermophilus [TaxId:274] [160797] (15 PDB entries)
   Uniprot Q72I19 11-81! Uniprot Q72I19 82-170

8. Domain d2v47h2: 2v47 H:83-171 [152513]
   Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47y1, d2v47z1

Details for d2v47h2

PDB Entry: 2v47, 3.8 Å

PDB Description: Structure of the Ribosome Recycling Factor bound to the Thermus thermophilus 70S ribosome with mRNA, ASL-Phe and tRNA-fMet (Part 2 of 4). This file contains the 50S subunit for Molecule 1.

PDB Compounds: (H:) 50S ribosomal protein L6

SCOPe Domain Sequences for d2v47h2:

Sequence; same for both SEQRES and ATOM records:

>d2v47h2 d.141.1.1 (H:83-171) Ribosomal protein L6 {Thermus thermophilus [TaxId: 274]}
yskellikgigyrarlvgraleltvgfshpvvveppegitfevpeptrvrvsgidkqkvg
qvaanirairkpsayhekgiyyagepvrl

Timeline for d2v47h2:

• d2v47h2 first appeared in SCOP 1.75
  
• d2v47h2 appears in SCOPe 2.07