![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) ![]() many known members contain KOW motif |
![]() | Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
![]() | Protein Ribosomal proteins L24 (L24p) [50106] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [159025] (15 PDB entries) Uniprot Q72I15 2-102 |
![]() | Domain d2v47y1: 2v47 Y:2-102 [152519] Other proteins in same PDB: d2v4741, d2v4751, d2v4761, d2v4771, d2v47c1, d2v47e1, d2v47f1, d2v47h1, d2v47h2, d2v47n1, d2v47p1, d2v47t1, d2v47u1, d2v47v1, d2v47z1 |
PDB Entry: 2v47 (more details), 3.8 Å
SCOPe Domain Sequences for d2v47y1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v47y1 b.34.5.1 (Y:2-102) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]} rvkmhvkkgdtvlvasgkykgrvgkvkevlpkkyavivegvnivkkavrvspkypqggfi ekeaplhaskvrpicpacgkptrvrkkflengkkirvcakc
Timeline for d2v47y1: