Lineage for d2uxxa3 (2uxx A:655-763)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935244Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 2935245Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 2935459Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 2935483Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species)
  7. 2935484Species Human (Homo sapiens) [TaxId:9606] [159954] (27 PDB entries)
    Uniprot O60341 655-763
  8. 2935506Domain d2uxxa3: 2uxx A:655-763 [152312]
    Other proteins in same PDB: d2uxxa1, d2uxxa2, d2uxxb1, d2uxxb2
    automated match to d2iw5a3
    complexed with cl, faj, gol

Details for d2uxxa3

PDB Entry: 2uxx (more details), 2.74 Å

PDB Description: human lsd1 histone demethylase-corest in complex with an fad- tranylcypromine adduct
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2uxxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxxa3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi
menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy

SCOPe Domain Coordinates for d2uxxa3:

Click to download the PDB-style file with coordinates for d2uxxa3.
(The format of our PDB-style files is described here.)

Timeline for d2uxxa3: