Lineage for d2uxxb2 (2uxx B:376-441)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304501Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2304502Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2304761Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)
  6. 2304816Protein REST corepressor 1, CoREST [140165] (1 species)
  7. 2304817Species Human (Homo sapiens) [TaxId:9606] [140166] (23 PDB entries)
    Uniprot Q9UKL0 376-440
  8. 2304819Domain d2uxxb2: 2uxx B:376-441 [262234]
    Other proteins in same PDB: d2uxxa1, d2uxxa2, d2uxxa3, d2uxxb1
    automated match to d2iw5b1
    complexed with cl, faj, gol

Details for d2uxxb2

PDB Entry: 2uxx (more details), 2.74 Å

PDB Description: Human LSD1 Histone Demethylase-CoREST in complex with an FAD- tranylcypromine adduct
PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d2uxxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxxb2 a.4.1.3 (B:376-441) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweaeh

SCOPe Domain Coordinates for d2uxxb2:

Click to download the PDB-style file with coordinates for d2uxxb2.
(The format of our PDB-style files is described here.)

Timeline for d2uxxb2: