SCOPe 2.08: Domain d2uxxb2: 2uxx B:376-441

Lineage for d2uxxb2 (2uxx B:376-441)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.3: Myb/SANT domain [46739] (16 proteins)

6. Protein REST corepressor 1, CoREST [140165] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140166] (23 PDB entries)
   Uniprot Q9UKL0 376-440

8. Domain d2uxxb2: 2uxx B:376-441 [262234]
   Other proteins in same PDB: d2uxxa1, d2uxxa2, d2uxxa3, d2uxxb1
   automated match to d2iw5b1
   complexed with cl, faj, gol
   has additional insertions and/or extensions that are not grouped together

Details for d2uxxb2

PDB Entry: 2uxx, 2.74 Å

PDB Description: human lsd1 histone demethylase-corest in complex with an fad- tranylcypromine adduct

PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d2uxxb2:

Sequence; same for both SEQRES and ATOM records:

>d2uxxb2 a.4.1.3 (B:376-441) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]}
iqkcnarwtteeqllavqairkygrdfqaisdvignksvvqvknffvnyrrrfnidevlq
eweaeh

Timeline for d2uxxb2:

• d2uxxb2 first appeared in SCOPe 2.05
  
• d2uxxb2 appears in SCOPe 2.07