Lineage for d2uxxa3 (2uxx A:655-763)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 854919Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 854920Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 855121Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 855145Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species)
  7. 855146Species Human (Homo sapiens) [TaxId:9606] [159954] (8 PDB entries)
    Uniprot O60341 655-763
  8. 855152Domain d2uxxa3: 2uxx A:655-763 [152312]
    Other proteins in same PDB: d2uxxa1, d2uxxa2
    automatically matched to 2IW5 A:655-763
    complexed with cl, fa9, gol

Details for d2uxxa3

PDB Entry: 2uxx (more details), 2.74 Å

PDB Description: human lsd1 histone demethylase-corest in complex with an fad- tranylcypromine adduct
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOP Domain Sequences for d2uxxa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uxxa3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi
menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy

SCOP Domain Coordinates for d2uxxa3:

Click to download the PDB-style file with coordinates for d2uxxa3.
(The format of our PDB-style files is described here.)

Timeline for d2uxxa3: