Lineage for d1lhsa_ (1lhs A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 protein domains)
    Heme-binding protein
  6. 2301126Protein Myoglobin [46469] (10 species)
  7. 2301226Species Loggerhead sea turtle (Caretta caretta) [TaxId:8467] [46477] (2 PDB entries)
  8. 2301227Domain d1lhsa_: 1lhs A: [15206]
    complexed with hem

Details for d1lhsa_

PDB Entry: 1lhs (more details), 2 Å

PDB Description: loggerhead sea turtle myoglobin (aquo-met)
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1lhsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lhsa_ a.1.1.2 (A:) Myoglobin {Loggerhead sea turtle (Caretta caretta) [TaxId: 8467]}
glsddewnhvlgiwakvepdlsahgqeviirlfqlhpetqerfakfknlttidalkssee
vkkhgttvltalgrilkqknnheqelkplaeshatkhkipvkyleficeiivkviaekhp
sdfgadsqaamkkalelfrndmaskykefgfqg

SCOPe Domain Coordinates for d1lhsa_:

Click to download the PDB-style file with coordinates for d1lhsa_.
(The format of our PDB-style files is described here.)

Timeline for d1lhsa_: