SCOPe 2.08: Domain d1lhsa_: 1lhs A:

Lineage for d1lhsa_ (1lhs A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (11 species)

7. Species Loggerhead sea turtle (Caretta caretta) [TaxId:8467] [46477] (2 PDB entries)

8. Domain d1lhsa_: 1lhs A: [15206]
   complexed with hem

Details for d1lhsa_

PDB Entry: 1lhs, 2 Å

PDB Description: loggerhead sea turtle myoglobin (aquo-met)

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d1lhsa_:

Sequence; same for both SEQRES and ATOM records:

>d1lhsa_ a.1.1.2 (A:) Myoglobin {Loggerhead sea turtle (Caretta caretta) [TaxId: 8467]}
glsddewnhvlgiwakvepdlsahgqeviirlfqlhpetqerfakfknlttidalkssee
vkkhgttvltalgrilkqknnheqelkplaeshatkhkipvkyleficeiivkviaekhp
sdfgadsqaamkkalelfrndmaskykefgfqg

Timeline for d1lhsa_:

• d1lhsa_ first appeared (with stable ids) in SCOP 1.55, called d1lhs__
  
• d1lhsa_ appears in SCOPe 2.07