Lineage for d1lhs__ (1lhs -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 4Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 11Family a.1.1.2: Globins [46463] (16 proteins)
  6. 533Protein Myoglobin [46469] (9 species)
  7. 554Species Loggerhead sea turtle (Caretta caretta) [TaxId:8467] [46477] (2 PDB entries)
  8. 556Domain d1lhs__: 1lhs - [15206]

Details for d1lhs__

PDB Entry: 1lhs (more details), 2 Å

PDB Description: loggerhead sea turtle myoglobin (aquo-met)

SCOP Domain Sequences for d1lhs__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lhs__ a.1.1.2 (-) Myoglobin {Loggerhead sea turtle (Caretta caretta)}
glsddewnhvlgiwakvepdlsahgqeviirlfqlhpetqerfakfknlttidalkssee
vkkhgttvltalgrilkqknnheqelkplaeshatkhkipvkyleficeiivkviaekhp
sdfgadsqaamkkalelfrndmaskykefgfqg

SCOP Domain Coordinates for d1lhs__:

Click to download the PDB-style file with coordinates for d1lhs__.
(The format of our PDB-style files is described here.)

Timeline for d1lhs__: