Lineage for d1lht__ (1lht -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.1: Globin-like [46457] (2 superfamilies) Superfamily a.1.1: Globin-like [46458] (3 families) 
Family a.1.1.2: Globins [46463] (16 proteins) Protein Myoglobin [46469] (9 species) 
Species Loggerhead sea turtle (Caretta caretta) [TaxId:8467] [46477] (2 PDB entries) 
Domain d1lht__: 1lht - [15205]
Details for d1lht__
PDB Entry: 1lht (more details), 2 Å
PDB Description: loggerhead sea turtle myoglobin (cyano-met)
SCOP Domain Sequences for d1lht__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lht__ a.1.1.2 (-) Myoglobin {Loggerhead sea turtle (Caretta caretta)}
glsddewnhvlgiwakvepdlsahgqeviirlfqlhpetqerfakfknlttidalkssee
vkkhgttvltalgrilkqknnheqelkplaeshatkhkipvkyleficeiivkviaekhp
sdfgadsqaamkkalelfrndmaskykefgfqg
SCOP Domain Coordinates for d1lht__:
Click to download the PDB-style file with coordinates for d1lht__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lht__:
- d1lht__ appears in SCOP 1.57
- d1lht__ appears in the current release, SCOPe 2.08, called d1lhta_
View in 3D