|  | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) | 
|  | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes | 
|  | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)  division into families based on beta-sheet topologies | 
|  | Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest | 
|  | Protein Transducin (alpha subunit) [52623] (4 species) common fold is interrupted with an all-alpha domain | 
|  | Species Mouse (Mus musculus) [TaxId:10090] [142225] (4 PDB entries) Uniprot P21279 38-66,184-354! Uniprot P27600 53-81,204-370! Uniprot P27601 47-75,202-372 | 
|  | Domain d2rgna2: 2rgn A:38-66,A:184-354 [152013] Other proteins in same PDB: d2rgna1, d2rgnc1, d2rgnd1, d2rgnf1 automatically matched to d2bcjq2 complexed with alf, gdp, mg | 
PDB Entry: 2rgn (more details), 3.5 Å
SCOPe Domain Sequences for d2rgna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rgna2 c.37.1.8 (A:38-66,A:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}
relkllllgtgesgkstfikqmriihgsgXvpttgiieypfdlqsvifrmvdvggqrser
rkwihcfenvtsimflvalseydqvlvesdnenrmeeskalfrtiitypwfqnssvilfl
nkkdlleekimyshlvdyfpeydgpqrdaqaarefilkmfvdlnpdsdkiiyshftcatd
tenirfvfaavkdtilqlnlk
Timeline for d2rgna2:
|  View in 3D Domains from other chains: (mouse over for more information) d2rgnc1, d2rgnd1, d2rgnd2, d2rgnf1 |