Lineage for d2rgnd1 (2rgn D:67-183)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1091526Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 1091527Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 1091528Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 1091529Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 1091566Species Mouse (Mus musculus) [TaxId:10090] [140674] (4 PDB entries)
    Uniprot P21279 67-183! Uniprot P27600 82-203! Uniprot P27601 76-201
  8. 1091572Domain d2rgnd1: 2rgn D:67-183 [152015]
    Other proteins in same PDB: d2rgna2, d2rgnc1, d2rgnd2, d2rgnf1
    automatically matched to d2bcjq1
    complexed with alf, gdp, mg

Details for d2rgnd1

PDB Entry: 2rgn (more details), 3.5 Å

PDB Description: crystal structure of p63rhogef complex with galpha-q and rhoa
PDB Compounds: (D:) Guanine nucleotide-binding protein G(q) subunit alpha, Guanine nucleotide-binding protein G(i) subunit alpha-1

SCOPe Domain Sequences for d2rgnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rgnd1 a.66.1.1 (D:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]}
ysdedkrgftklvyqniftamqamiramdtlkipykyehnkahaqlvrevdvekvsafen
pyvdaikslwndpgiqecydrrreyqlsdstkyylndldrvadpsylptqqdvlrvr

SCOPe Domain Coordinates for d2rgnd1:

Click to download the PDB-style file with coordinates for d2rgnd1.
(The format of our PDB-style files is described here.)

Timeline for d2rgnd1: