SCOPe 2.08: Domain d2r87f2: 2r87 F:100-334

Lineage for d2r87f2 (2r87 F:100-334)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.9: PurP ATP-binding domain-like [160804] (1 protein)
   Pfam PF06973; DUF1297

6. Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [160805] (3 species)

7. Species Pyrococcus furiosus [TaxId:2261] [160808] (4 PDB entries)
   Uniprot Q8U0R7 100-334

8. Domain d2r87f2: 2r87 F:100-334 [151695]
   Other proteins in same PDB: d2r87a1, d2r87b1, d2r87c1, d2r87d1, d2r87e1, d2r87f1
   automated match to d2r84a2
   complexed with adp, po4

Details for d2r87f2

PDB Entry: 2r87, 2.3 Å

PDB Description: crystal structure of purp from pyrococcus furiosus complexed with adp

PDB Compounds: (F:) PurP protein PF1517

SCOPe Domain Sequences for d2r87f2:

Sequence; same for both SEQRES and ATOM records:

>d2r87f2 d.142.1.9 (F:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]}
drnlerkwlkkagirvpevyedpddiekpvivkphgakggkgyflakdpedfwrkaekfl
gikrkedlkniqiqeyvlgvpvyphyfyskvreelelmsidrryesnvdaigripakdql
efdmditytvignipivlresllmdvieagervvkaaeelmgglwgpfclegvftpdlef
vvfeisarivagtnifvngspytwlrydrpvstgrriameireaiendmlekvlt

Timeline for d2r87f2:

• d2r87f2 first appeared in SCOP 1.75
  
• d2r87f2 appears in SCOPe 2.07