| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.8: PurP N-terminal domain-like [159526] (1 protein) Pfam PF06849; DUF1246 |
| Protein 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP [159527] (3 species) |
| Species Pyrococcus furiosus [TaxId:2261] [159528] (4 PDB entries) Uniprot Q8U0R7 1-99 |
| Domain d2r87b1: 2r87 B:1-99 [151686] Other proteins in same PDB: d2r87a2, d2r87b2, d2r87c2, d2r87d2, d2r87e2, d2r87f2 automated match to d2r84a1 complexed with adp, po4 |
PDB Entry: 2r87 (more details), 2.3 Å
SCOPe Domain Sequences for d2r87b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r87b1 c.30.1.8 (B:1-99) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]}
mkvriatyashsalqilkgakdegfetiafgsskvkplytkyfpvadyfieekypeeell
nlnavvvptgsfvahlgielvenmkvpyfgnkrvlrwes
Timeline for d2r87b1: